PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_08447A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family NAC
Protein Properties Length: 337aa    MW: 36734.6 Da    PI: 7.5502
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_08447AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM179.21.1e-5551301128
                        NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWk 84 
                                lppGfrFhPtdeelv++yL++k+++  +++ ++i++vd++k+ePwdLp k++ +ekewyfFs rd+ky+tg r+nrat+sgyWk
  Oropetium_20150105_08447A   5 LPPGFRFHPTDEELVTYYLTRKASDFAFTT-RAIADVDLNKCEPWDLPGKASMGEKEWYFFSMRDRKYPTGIRTNRATDSGYWK 87 
                                79*************************999.89***************988999****************************** PP

                        NAM  85 atgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                                +tgkdke+++  g lvg+kktLvfy+grapkgekt+Wvmheyrl
  Oropetium_20150105_08447A  88 TTGKDKEIFH-CGMLVGMKKTLVFYRGRAPKGEKTSWVMHEYRL 130
                                **********.99*****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.83E-643151IPR003441NAC domain
PROSITE profilePS5100560.2335151IPR003441NAC domain
PfamPF023656.2E-296130IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 337 aa     Download sequence    Send to blast
MEEGLPPGFR FHPTDEELVT YYLTRKASDF AFTTRAIADV DLNKCEPWDL PGKASMGEKE  60
WYFFSMRDRK YPTGIRTNRA TDSGYWKTTG KDKEIFHCGM LVGMKKTLVF YRGRAPKGEK  120
TSWVMHEYRL QNKFPYKPNK DEWVVCRVFK KCQVIKMRPP TGSPTMDSPC HDANNASLGE  180
LGELDVSSIL GGLAPSSVHT SSSSPAGEGN FVGHRAVDMS AYMSWMAAAN QGAAAAAAAA  240
AMLPWAPGLF GNVFAAAPNQ LGPQKSLQYA AGCSPSHQPR EIIGGVVANL GGGGDHHAMF  300
GSSVAKVDME CDQQQHPPQP PEQQLGMDDS TWRAFG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A7e-58515117165NO APICAL MERISTEM PROTEIN
1ut4_B7e-58515117165NO APICAL MERISTEM PROTEIN
1ut7_A7e-58515117165NO APICAL MERISTEM PROTEIN
1ut7_B7e-58515117165NO APICAL MERISTEM PROTEIN
3swm_A8e-58515120168NAC domain-containing protein 19
3swm_B8e-58515120168NAC domain-containing protein 19
3swm_C8e-58515120168NAC domain-containing protein 19
3swm_D8e-58515120168NAC domain-containing protein 19
3swp_A8e-58515120168NAC domain-containing protein 19
3swp_B8e-58515120168NAC domain-containing protein 19
3swp_C8e-58515120168NAC domain-containing protein 19
3swp_D8e-58515120168NAC domain-containing protein 19
4dul_A7e-58515117165NAC domain-containing protein 19
4dul_B7e-58515117165NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00364DAPTransfer from AT3G18400Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3631710.0AK363171.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2013D22.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002466794.11e-168hypothetical protein SORBIDRAFT_01g014310
TrEMBLC5WS741e-168C5WS74_SORBI; Putative uncharacterized protein Sb01g014310
STRINGSb01g014310.11e-167(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP79193450
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18400.11e-93NAC domain containing protein 58